TIGD4 antibody (70R-2988)

Rabbit polyclonal TIGD4 antibody raised against the N terminal of TIGD4

Synonyms Polyclonal TIGD4 antibody, Anti-TIGD4 antibody, TIGD-4, TIGD 4 antibody, TIGD 4, Tigger Transposable Element Derived 4 antibody, TIGD4, MGC43837 antibody, TIGD-4 antibody
Specificity TIGD4 antibody was raised against the N terminal of TIGD4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TIGD4 antibody was raised using the N terminal of TIGD4 corresponding to a region with amino acids RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK
Assay Information TIGD4 Blocking Peptide, catalog no. 33R-7898, is also available for use as a blocking control in assays to test for specificity of this TIGD4 antibody

Images

Western Blot analysis using TIGD4 antibody (70R-2988)

TIGD4 antibody (70R-2988) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TIGD4 antibody (70R-2988) | TIGD4 antibody (70R-2988) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors