TIGD4 antibody (70R-2988)
Rabbit polyclonal TIGD4 antibody raised against the N terminal of TIGD4
Overview
Overview
| Synonyms | Polyclonal TIGD4 antibody, Anti-TIGD4 antibody, TIGD-4, TIGD 4 antibody, TIGD 4, Tigger Transposable Element Derived 4 antibody, TIGD4, MGC43837 antibody, TIGD-4 antibody |
|---|---|
| Specificity | TIGD4 antibody was raised against the N terminal of TIGD4 |
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | TIGD4 antibody was raised using the N terminal of TIGD4 corresponding to a region with amino acids RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK |
| Assay Information | TIGD4 Blocking Peptide, catalog no. 33R-7898, is also available for use as a blocking control in assays to test for specificity of this TIGD4 antibody |
Images
Western Blot analysis using TIGD4 antibody (70R-2988)
TIGD4 antibody (70R-2988) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 57 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product