FBXW10 antibody (70R-3251)
Rabbit polyclonal FBXW10 antibody raised against the middle region of FBXW10
Overview
Overview
| Synonyms | Polyclonal FBXW10 antibody, Anti-FBXW10 antibody, HREP antibody, F-Box And Wd Repeat Domain Containing 10 antibody, Fbw10 antibody, SM25H2 antibody, FBXW 10, SM2SH2 antibody, FBXW-10, FBXW-10 antibody, FBXW 10 antibody, FBXW10 |
|---|---|
| Specificity | FBXW10 antibody was raised against the middle region of FBXW10 |
| Cross Reactivity | Human,Mouse |
| Applications | WB |
| Immunogen | FBXW10 antibody was raised using the middle region of FBXW10 corresponding to a region with amino acids RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD |
| Assay Information | FBXW10 Blocking Peptide, catalog no. 33R-7996, is also available for use as a blocking control in assays to test for specificity of this FBXW10 antibody |
Images
Western Blot analysis using FBXW10 antibody (70R-3251)
FBXW10 antibody (70R-3251) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 120 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product