C16ORF48 antibody (70R-3273)
Rabbit polyclonal C16ORF48 antibody raised against the middle region of C16Orf48
Overview
Overview
| Synonyms | Polyclonal C16ORF48 antibody, Anti-C16ORF48 antibody, Chromosome ORF-16 antibody, Chromosome ORF 16 antibody, DAKV6410 antibody, Chromosome ORF-16, Chromosome ORF 16, Chromosome 16 ORF, DKFZP434A1319 antibody |
|---|---|
| Specificity | C16ORF48 antibody was raised against the middle region of C16Orf48 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | C16ORF48 antibody was raised using the middle region of C16Orf48 corresponding to a region with amino acids RHSCSLQVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARK |
| Assay Information | C16ORF48 Blocking Peptide, catalog no. 33R-7956, is also available for use as a blocking control in assays to test for specificity of this C16ORF48 antibody |
Images
Western Blot analysis using C16ORF48 antibody (70R-3273)
C16ORF48 antibody (70R-3273) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 39 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of C16orf48 protein has not been widely studied, and is yet to be fully elucidated. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product