C16ORF48 antibody (70R-3273)

Rabbit polyclonal C16ORF48 antibody raised against the middle region of C16Orf48

Synonyms Polyclonal C16ORF48 antibody, Anti-C16ORF48 antibody, Chromosome ORF-16 antibody, Chromosome ORF 16 antibody, DAKV6410 antibody, Chromosome ORF-16, Chromosome ORF 16, Chromosome 16 ORF, DKFZP434A1319 antibody
Specificity C16ORF48 antibody was raised against the middle region of C16Orf48
Cross Reactivity Human
Applications WB
Immunogen C16ORF48 antibody was raised using the middle region of C16Orf48 corresponding to a region with amino acids RHSCSLQVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARK
Assay Information C16ORF48 Blocking Peptide, catalog no. 33R-7956, is also available for use as a blocking control in assays to test for specificity of this C16ORF48 antibody

Images

Western Blot analysis using C16ORF48 antibody (70R-3273)

C16ORF48 antibody (70R-3273) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C16orf48 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C16ORF48 antibody (70R-3273) | C16ORF48 antibody (70R-3273) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors