TADA1L antibody (70R-3587)
Rabbit polyclonal TADA1L antibody
Overview
Overview
| Synonyms | Polyclonal TADA1L antibody, Anti-TADA1L antibody, KIAA0764 antibody, TADAL-1 antibody, RP1-9E21.4 antibody, TADAL 1, STAF42 antibody, TADA1L, TADAL-1, Transcriptional Adaptor 1 antibody, TADAL 1 antibody, Hfi1 Homolog Yeast-Like antibody |
|---|---|
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | TADA1L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC |
| Assay Information | TADA1L Blocking Peptide, catalog no. 33R-7893, is also available for use as a blocking control in assays to test for specificity of this TADA1L antibody |
Images
Western Blot analysis using TADA1L antibody (70R-3587)
TADA1L antibody (70R-3587) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 37 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product