TADA1L antibody (70R-3587)

Rabbit polyclonal TADA1L antibody

Synonyms Polyclonal TADA1L antibody, Anti-TADA1L antibody, KIAA0764 antibody, TADAL-1 antibody, RP1-9E21.4 antibody, TADAL 1, STAF42 antibody, TADA1L, TADAL-1, Transcriptional Adaptor 1 antibody, TADAL 1 antibody, Hfi1 Homolog Yeast-Like antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TADA1L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
Assay Information TADA1L Blocking Peptide, catalog no. 33R-7893, is also available for use as a blocking control in assays to test for specificity of this TADA1L antibody

Images

Western Blot analysis using TADA1L antibody (70R-3587)

TADA1L antibody (70R-3587) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TADA1L antibody (70R-3587) | TADA1L antibody (70R-3587) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors