ST14 antibody (70R-3613)
Rabbit polyclonal ST14 antibody
Overview
Overview
| Synonyms | Polyclonal ST14 antibody, Anti-ST14 antibody, Colon Carcinoma antibody, ST 14, HAI antibody, ST-14, TADG-15 antibody, PRSS14 antibody, SNC19 antibody, MTSP1 antibody, ST-14 antibody, Suppression Of Tumorigenicity 14 antibody, MTSP-1 antibody, ST14, MT-SP1 antibody, ST 14 antibody |
|---|---|
| Cross Reactivity | Human,Mouse,Rat |
| Applications | IHC, WB |
| Immunogen | ST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT |
| Assay Information | ST14 Blocking Peptide, catalog no. 33R-8520, is also available for use as a blocking control in assays to test for specificity of this ST14 antibody |
Images
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 46 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 0.25 ug/ml; IHC: 4-8 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product