RIOK2 antibody (70R-3723)
Rabbit polyclonal RIOK2 antibody
Overview
Overview
| Synonyms | Polyclonal RIOK2 antibody, Anti-RIOK2 antibody, RIOK 2, RIOK-2 antibody, RIOK 2 antibody, Rio Kinase 2 antibody, RIOK-2, RIOK2, FLJ11159 antibody |
|---|---|
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | RIOK2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRL |
| Assay Information | RIOK2 Blocking Peptide, catalog no. 33R-8357, is also available for use as a blocking control in assays to test for specificity of this RIOK2 antibody |
Images
Western Blot analysis using RIOK2 antibody (70R-3723)
RIOK2 antibody (70R-3723) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 63 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of RIOK2 protein is not widely studied, and is yet to be elucidated fully. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product