XAF1 antibody (70R-3726)
Rabbit polyclonal XAF1 antibody raised against the middle region of XAF1
Overview
Overview
| Synonyms | Polyclonal XAF1 antibody, Anti-XAF1 antibody, XAF-1 antibody, BIRC4BP antibody, HSXIAPAF1 antibody, XAF-1, Xiap Associated Factor 1 antibody, XAF 1 antibody, XAF1, XAF 1 |
|---|---|
| Specificity | XAF1 antibody was raised against the middle region of XAF1 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | XAF1 antibody was raised using the middle region of XAF1 corresponding to a region with amino acids RSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDIL |
| Assay Information | XAF1 Blocking Peptide, catalog no. 33R-8184, is also available for use as a blocking control in assays to test for specificity of this XAF1 antibody |
Images
Western Blot analysis using XAF1 antibody (70R-3726)
XAF1 antibody (70R-3726) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 34 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | X-linked inhibitor of apoptosis is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product