GAS8 antibody (70R-3968)
Rabbit polyclonal GAS8 antibody raised against the N terminal of GAS8
Overview
Overview
| Synonyms | Polyclonal GAS8 antibody, Anti-GAS8 antibody, MGC138326 antibody, Growth Arrest-Specific 8 antibody, GAS11 antibody |
|---|---|
| Specificity | GAS8 antibody was raised against the N terminal of GAS8 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | GAS8 antibody was raised using the N terminal of GAS8 corresponding to a region with amino acids VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM |
| Assay Information | GAS8 Blocking Peptide, catalog no. 33R-9820, is also available for use as a blocking control in assays to test for specificity of this GAS8 antibody |
Images
Western Blot analysis using GAS8 antibody (70R-3968)
GAS8 antibody (70R-3968) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 56 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product