SENP2 antibody (70R-3981)
Rabbit polyclonal SENP2 antibody raised against the middle region of SENP2
Overview
Overview
| Synonyms | Polyclonal SENP2 antibody, Anti-SENP2 antibody, SENP 2, Sumo1/Sentrin/Smt3 Specific Peptidase 2 antibody, KIAA1331 antibody, SENP-2 antibody, SENP-2, SENP 2 antibody, DKFZp762A2316 antibody, SENP2, SMT3IP2 antibody, AXAM2 antibody |
|---|---|
| Specificity | SENP2 antibody was raised against the middle region of SENP2 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | SENP2 antibody was raised using the middle region of SENP2 corresponding to a region with amino acids RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT |
| Assay Information | SENP2 Blocking Peptide, catalog no. 33R-7961, is also available for use as a blocking control in assays to test for specificity of this SENP2 antibody |
Images
Western Blot analysis using SENP2 antibody (70R-3981)
SENP2 antibody (70R-3981) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 68 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product