IER5L antibody (70R-4284)
Rabbit polyclonal IER5L antibody raised against the middle region of IER5L
Overview
Overview
| Synonyms | Polyclonal IER5L antibody, Anti-IER5L antibody, MGC70833 antibody, Immediate Early Response 5-Like antibody, IER-5, IER 5, IER-5 antibody, IER5, bA247A12.2 antibody, IER 5 antibody |
|---|---|
| Specificity | IER5L antibody was raised against the middle region of IER5L |
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | IER5L antibody was raised using the middle region of IER5L corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA |
| Assay Information | IER5L Blocking Peptide, catalog no. 33R-8655, is also available for use as a blocking control in assays to test for specificity of this IER5L antibody |
Images
Western Blot analysis using IER5L antibody (70R-4284)
IER5L antibody (70R-4284) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 42 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of IER5 protein is not widely studied, and is yet to be elucidated fully. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product