IER5L antibody (70R-4284)

Rabbit polyclonal IER5L antibody raised against the middle region of IER5L

Synonyms Polyclonal IER5L antibody, Anti-IER5L antibody, MGC70833 antibody, Immediate Early Response 5-Like antibody, IER-5, IER 5, IER-5 antibody, IER5, bA247A12.2 antibody, IER 5 antibody
Specificity IER5L antibody was raised against the middle region of IER5L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IER5L antibody was raised using the middle region of IER5L corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA
Assay Information IER5L Blocking Peptide, catalog no. 33R-8655, is also available for use as a blocking control in assays to test for specificity of this IER5L antibody

Images

Western Blot analysis using IER5L antibody (70R-4284)

IER5L antibody (70R-4284) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of IER5 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IER5L antibody (70R-4284) | IER5L antibody (70R-4284) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors