PSMD3 antibody (70R-4327)
Rabbit polyclonal PSMD3 antibody
Overview
Overview
| Synonyms | Polyclonal PSMD3 antibody, Anti-PSMD3 antibody, PSMD-3 antibody, Prosome Macropain 26S Subunit Non-Atpase 3 antibody, PSMD 3 antibody, RPN3 antibody, PSMD3, Proteasome macropain 26S subunit non-ATPase 3 antibody, S3 antibody, PSMD 3, PSMD-3, P58 antibody |
|---|---|
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS |
| Assay Information | PSMD3 Blocking Peptide, catalog no. 33R-8042, is also available for use as a blocking control in assays to test for specificity of this PSMD3 antibody |
Images
Western Blot analysis using PSMD3 antibody (70R-4327)
PSMD3 antibody (70R-4327) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 61 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product