LOC402573 antibody (70R-4441)
Rabbit polyclonal LOC402573 antibody raised against the C terminal of LOC402573
Overview
Overview
| Synonyms | Polyclonal LOC402573 antibody, Anti-LOC402573 antibody, LOC 402573, LOC402573, Hypothetical Loc402573 antibody, LOC 402573 antibody, LOC-402573 antibody, LOC-402573 |
|---|---|
| Specificity | LOC402573 antibody was raised against the C terminal of LOC402573 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | LOC402573 antibody was raised using the C terminal of LOC402573 corresponding to a region with amino acids YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL |
| Assay Information | LOC402573 Blocking Peptide, catalog no. 33R-10183, is also available for use as a blocking control in assays to test for specificity of this LOC402573 antibody |
Images
Western Blot analysis using LOC402573 antibody (70R-4441)
LOC402573 antibody (70R-4441) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 24 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of LOC402573 protein has not been widely studied, and is yet to be fully elucidated. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product