LOC402573 antibody (70R-4441)

Rabbit polyclonal LOC402573 antibody raised against the C terminal of LOC402573

Synonyms Polyclonal LOC402573 antibody, Anti-LOC402573 antibody, LOC 402573, LOC402573, Hypothetical Loc402573 antibody, LOC 402573 antibody, LOC-402573 antibody, LOC-402573
Specificity LOC402573 antibody was raised against the C terminal of LOC402573
Cross Reactivity Human
Applications WB
Immunogen LOC402573 antibody was raised using the C terminal of LOC402573 corresponding to a region with amino acids YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL
Assay Information LOC402573 Blocking Peptide, catalog no. 33R-10183, is also available for use as a blocking control in assays to test for specificity of this LOC402573 antibody

Images

Western Blot analysis using LOC402573 antibody (70R-4441)

LOC402573 antibody (70R-4441) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of LOC402573 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LOC402573 antibody (70R-4441) | LOC402573 antibody (70R-4441) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors