RABEPK antibody (70R-4503)
Rabbit polyclonal RABEPK antibody raised against the N terminal of RABEPK
Overview
Overview
| Synonyms | Polyclonal RABEPK antibody, Anti-RABEPK antibody, Rab9 Effector Protein With Kelch Motifs antibody, p40 antibody, bA65N13.1 antibody, RAB9P40 antibody, DKFZp686P1077 antibody |
|---|---|
| Specificity | RABEPK antibody was raised against the N terminal of RABEPK |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL |
| Assay Information | RABEPK Blocking Peptide, catalog no. 33R-8341, is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody |
Images
Western Blot analysis using RABEPK antibody (70R-4503)
RABEPK antibody (70R-4503) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 40 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product