RABEPK antibody (70R-4503)

Rabbit polyclonal RABEPK antibody raised against the N terminal of RABEPK

Synonyms Polyclonal RABEPK antibody, Anti-RABEPK antibody, Rab9 Effector Protein With Kelch Motifs antibody, p40 antibody, bA65N13.1 antibody, RAB9P40 antibody, DKFZp686P1077 antibody
Specificity RABEPK antibody was raised against the N terminal of RABEPK
Cross Reactivity Human
Applications WB
Immunogen RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL
Assay Information RABEPK Blocking Peptide, catalog no. 33R-8341, is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody

Images

Western Blot analysis using RABEPK antibody (70R-4503)

RABEPK antibody (70R-4503) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RABEPK antibody (70R-4503) | RABEPK antibody (70R-4503) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors