ARHGEF19 antibody (70R-4538)
Rabbit polyclonal ARHGEF19 antibody
Overview
Overview
| Synonyms | Polyclonal ARHGEF19 antibody, Anti-ARHGEF19 antibody, Gef 19 antibody, WGEF antibody, Rho RNA guanine Nucleotide Exchange Factor antibody, RP4-733M16.1 antibody, FLJ33962 antibody |
|---|---|
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS |
| Assay Information | ARHGEF19 Blocking Peptide, catalog no. 33R-7904, is also available for use as a blocking control in assays to test for specificity of this ARHGEF19 antibody |
Images
Western Blot analysis using ARHGEF19 antibody (70R-4538)
ARHGEF19 antibody (70R-4538) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 89 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product