BBS4 antibody (70R-4575)

Rabbit polyclonal BBS4 antibody raised against the N terminal of BBS4

Synonyms Polyclonal BBS4 antibody, Anti-BBS4 antibody, Bardet-Biedl Syndrome 4 antibody
Specificity BBS4 antibody was raised against the N terminal of BBS4
Cross Reactivity Human
Applications WB
Immunogen BBS4 antibody was raised using the N terminal of BBS4 corresponding to a region with amino acids YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA
Assay Information BBS4 Blocking Peptide, catalog no. 33R-10282, is also available for use as a blocking control in assays to test for specificity of this BBS4 antibody

Images

Western Blot analysis using BBS4 antibody (70R-4575)

BBS4 antibody (70R-4575) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse. The similar phenotypes exhibited by mutations in BBS gene family members are likely due to the protein's shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BBS4 antibody (70R-4575) | BBS4 antibody (70R-4575) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors