DDX55 antibody (70R-4786)
Rabbit polyclonal DDX55 antibody
Overview
Overview
| Synonyms | Polyclonal DDX55 antibody, Anti-DDX55 antibody, DDX-55 antibody, DDX55, Asp-Glu-Ala-Asp Box Polypeptide 55 antibody, DDX 55 antibody, DDX 55, Dead antibody, DDX-55 |
|---|---|
| Cross Reactivity | Human,Mouse |
| Applications | WB |
| Immunogen | DDX55 antibody was raised using a synthetic peptide corresponding to a region with amino acids RELAIQIDEVLSHFTKHFPEFSQILWIGGRNPGEDVERFKQQGGNIIVAT |
| Assay Information | DDX55 Blocking Peptide, catalog no. 33R-7874, is also available for use as a blocking control in assays to test for specificity of this DDX55 antibody |
Images
Western Blot analysis using DDX55 antibody (70R-4786)
DDX55 antibody (70R-4786) used at 0.5 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 66 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 0.5 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DDX55 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of only one transcript has been confirmed. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product