RBPMS antibody (70R-4898)

Rabbit polyclonal RBPMS antibody raised against the N terminal of RBPMS

Synonyms Polyclonal RBPMS antibody, Anti-RBPMS antibody, HERMES antibody, RNA Binding Protein With Multiple Splicing antibody
Specificity RBPMS antibody was raised against the N terminal of RBPMS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids RELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFD
Assay Information RBPMS Blocking Peptide, catalog no. 33R-7880, is also available for use as a blocking control in assays to test for specificity of this RBPMS antibody

Images

Western Blot analysis using RBPMS antibody (70R-4898)

RBPMS antibody (70R-4898) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBPMS antibody (70R-4898) | RBPMS antibody (70R-4898) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors