RBPMS antibody (70R-4898)
Rabbit polyclonal RBPMS antibody raised against the N terminal of RBPMS
Overview
Overview
| Synonyms | Polyclonal RBPMS antibody, Anti-RBPMS antibody, HERMES antibody, RNA Binding Protein With Multiple Splicing antibody |
|---|---|
| Specificity | RBPMS antibody was raised against the N terminal of RBPMS |
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids RELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFD |
| Assay Information | RBPMS Blocking Peptide, catalog no. 33R-7880, is also available for use as a blocking control in assays to test for specificity of this RBPMS antibody |
Images
Western Blot analysis using RBPMS antibody (70R-4898)
RBPMS antibody (70R-4898) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 22 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product