NEURL antibody (70R-5243)
Rabbit polyclonal NEURL antibody
Overview
Overview
| Synonyms | Polyclonal NEURL antibody, Anti-NEURL antibody, NEURL1 antibody, RNF67 antibody, h-neu antibody, Neuralized Homolog antibody |
|---|---|
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | NEURL antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKA |
| Assay Information | NEURL Blocking Peptide, catalog no. 33R-8032, is also available for use as a blocking control in assays to test for specificity of this NEURL antibody |
Images
Western Blot analysis using NEURL antibody (70R-5243)
NEURL antibody (70R-5243) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 62 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | NEURL may be involved in protein binding, zinc ion binding and metal ion binding. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product