OAT antibody (70R-5318)

Rabbit polyclonal OAT antibody

Synonyms Polyclonal OAT antibody, Anti-OAT antibody, Gyrate Atrophy antibody, HOGA antibody, Ornithine Aminotransferase antibody, DKFZp781A11155 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMV
Assay Information OAT Blocking Peptide, catalog no. 33R-8230, is also available for use as a blocking control in assays to test for specificity of this OAT antibody

Images

Western Blot analysis using OAT antibody (70R-5318)

OAT antibody (70R-5318) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OAT is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OAT antibody (70R-5318) | OAT antibody (70R-5318) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors