OAT antibody (70R-5318)
Rabbit polyclonal OAT antibody
Overview
Overview
| Synonyms | Polyclonal OAT antibody, Anti-OAT antibody, Gyrate Atrophy antibody, HOGA antibody, Ornithine Aminotransferase antibody, DKFZp781A11155 antibody |
|---|---|
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMV |
| Assay Information | OAT Blocking Peptide, catalog no. 33R-8230, is also available for use as a blocking control in assays to test for specificity of this OAT antibody |
Images
Western Blot analysis using OAT antibody (70R-5318)
OAT antibody (70R-5318) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 45 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | OAT is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product