EPHX1 antibody (70R-5355)
Rabbit polyclonal EPHX1 antibody
Overview
Overview
| Synonyms | Polyclonal EPHX1 antibody, Anti-EPHX1 antibody, EPHX-1, EPHX-1 antibody, EPHX1, EPOX antibody, EPHX 1, MEH antibody, EPHX antibody, EPHX 1 antibody, Epoxide Hydrolase 1 Microsomal antibody |
|---|---|
| Cross Reactivity | Human,Mouse |
| Applications | WB |
| Immunogen | EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI |
| Assay Information | EPHX1 Blocking Peptide, catalog no. 33R-1773, is also available for use as a blocking control in assays to test for specificity of this EPHX1 antibody |
Images
Western Blot analysis using EPHX1 antibody (70R-5355)
EPHX1 antibody (70R-5355) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 53 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product