PON1 antibody (70R-5361)

Rabbit polyclonal PON1 antibody raised against the middle region of PON1

Synonyms Polyclonal PON1 antibody, Anti-PON1 antibody, PON1, PON-1, PON antibody, PON-1 antibody, PON 1 antibody, Paraoxonase 1 antibody, PON 1, ESA antibody
Specificity PON1 antibody was raised against the middle region of PON1
Cross Reactivity Human
Applications WB
Immunogen PON1 antibody was raised using the middle region of PON1 corresponding to a region with amino acids VVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDF
Assay Information PON1 Blocking Peptide, catalog no. 33R-9864, is also available for use as a blocking control in assays to test for specificity of this PON1 antibody

Images

Western Blot analysis using PON1 antibody (70R-5361)

PON1 antibody (70R-5361) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PON1 antibody (70R-5361) | PON1 antibody (70R-5361) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors