PON1 antibody (70R-5361)
Rabbit polyclonal PON1 antibody raised against the middle region of PON1
Overview
Overview
| Synonyms | Polyclonal PON1 antibody, Anti-PON1 antibody, PON1, PON-1, PON antibody, PON-1 antibody, PON 1 antibody, Paraoxonase 1 antibody, PON 1, ESA antibody |
|---|---|
| Specificity | PON1 antibody was raised against the middle region of PON1 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | PON1 antibody was raised using the middle region of PON1 corresponding to a region with amino acids VVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDF |
| Assay Information | PON1 Blocking Peptide, catalog no. 33R-9864, is also available for use as a blocking control in assays to test for specificity of this PON1 antibody |
Images
Western Blot analysis using PON1 antibody (70R-5361)
PON1 antibody (70R-5361) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 40 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product