C1QTNF4 antibody (70R-5437)

Rabbit polyclonal C1QTNF4 antibody raised against the middle region of C1QTNF4

Synonyms Polyclonal C1QTNF4 antibody, Anti-C1QTNF4 antibody, ZACRP4 antibody, CQTNF 1 antibody, CQTNF 1, CTRP4 antibody, CQTNF-1 antibody, C1Q And Tumor Necrosis Factor Related Protein 4 antibody, CQTNF-1, C1QTNF
Specificity C1QTNF4 antibody was raised against the middle region of C1QTNF4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids RRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASEL
Assay Information C1QTNF4 Blocking Peptide, catalog no. 33R-8139, is also available for use as a blocking control in assays to test for specificity of this C1QTNF4 antibody

Images

Western Blot analysis using C1QTNF4 antibody (70R-5437)

C1QTNF4 antibody (70R-5437) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C1QTNF4 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C1QTNF4 antibody (70R-5437) | C1QTNF4 antibody (70R-5437) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €282.21
Size: 50 ug
OR
Shipping
View Our Distributors