C1QTNF4 antibody (70R-5437)
Rabbit polyclonal C1QTNF4 antibody raised against the middle region of C1QTNF4
Overview
Overview
| Synonyms | Polyclonal C1QTNF4 antibody, Anti-C1QTNF4 antibody, ZACRP4 antibody, CQTNF 1 antibody, CQTNF 1, CTRP4 antibody, CQTNF-1 antibody, C1Q And Tumor Necrosis Factor Related Protein 4 antibody, CQTNF-1, C1QTNF |
|---|---|
| Specificity | C1QTNF4 antibody was raised against the middle region of C1QTNF4 |
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids RRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASEL |
| Assay Information | C1QTNF4 Blocking Peptide, catalog no. 33R-8139, is also available for use as a blocking control in assays to test for specificity of this C1QTNF4 antibody |
Images
Western Blot analysis using C1QTNF4 antibody (70R-5437)
C1QTNF4 antibody (70R-5437) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 35 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The specific function of C1QTNF4 is not yet known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product