STAMBP antibody (70R-5741)
Rabbit polyclonal STAMBP antibody raised against the N terminal of STAMBP
Overview
Overview
| Synonyms | Polyclonal STAMBP antibody, Anti-STAMBP antibody, MGC126518 antibody, Stam Binding Protein antibody, AMSH antibody, MGC126516 antibody |
|---|---|
| Specificity | STAMBP antibody was raised against the N terminal of STAMBP |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | STAMBP antibody was raised using the N terminal of STAMBP corresponding to a region with amino acids SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS |
| Assay Information | STAMBP Blocking Peptide, catalog no. 33R-8355, is also available for use as a blocking control in assays to test for specificity of this STAMBP antibody |
Images
Western Blot analysis using STAMBP antibody (70R-5741)
STAMBP antibody (70R-5741) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 48 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. STAMBP binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product