This websites use cookies. By continuing to browse the site you are agreeing to our use of cookies.
United States ($)
United Kingdom (£)
Europe (€)
JavaScript seems to be disabled in your browser.
You must have JavaScript enabled in your browser to utilize the functionality of this website.
MKNK2 antibody (70R-5832)
Rabbit polyclonal MKNK2 antibody raised against the N terminal of MKNK2
Synonyms
Polyclonal MKNK2 antibody, Anti-MKNK2 antibody, MKNK-2, MNK2 antibody, MKNK 2, Map Kinase Interacting Serine/Threonine Kinase 2 antibody, MKNK2, MKNK-2 antibody, GPRK7 antibody, MKNK 2 antibody
Specificity
MKNK2 antibody was raised against the N terminal of MKNK2
Cross Reactivity
Human,Mouse,Rat
Applications
WB
Immunogen
MKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL
Assay Information
MKNK2 Blocking Peptide, catalog no. 33R-8351, is also available for use as a blocking control in assays to test for specificity of this MKNK2 antibody
Specifications
Host
Rabbit
Method of Purification
Affinity purified
Molecular Weight
51 kDa (MW of target protein)
Form & Buffer
Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
1 mg/ml
Usage & Assay Information
Usage Recommendations
WB: 1 ug/ml
Storage & Safety
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
General Information
Biological Significance
MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.
References
Add a Paper
Have you referenced this product?
Sorry, but there are no references currently for this product.
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product
Availability: In stock
Price:
€282.21
Size: 50 ug