RAB40A antibody (70R-5855)
Rabbit polyclonal RAB40A antibody raised against the middle region of RAB40A
Overview
Overview
| Synonyms | Polyclonal RAB40A antibody, Anti-RAB40A antibody, RAR2A antibody, MGC142061 antibody, RABA 40 antibody, Rab40A Member Ras Oncogene Family antibody, RABA 40, Rar-2 antibody, RABA-40 antibody, RAB40A, RABA-40 |
|---|---|
| Specificity | RAB40A antibody was raised against the middle region of RAB40A |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR |
| Assay Information | RAB40A Blocking Peptide, catalog no. 33R-8107, is also available for use as a blocking control in assays to test for specificity of this RAB40A antibody |
Images
Western Blot analysis using RAB40A antibody (70R-5855)
RAB40A antibody (70R-5855) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 31 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RAB40A belongs to the small GTPase superfamily, Rab family. It contains 1 SOCS box domain. RAB40A may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product