RAB5A antibody (70R-5861)

Rabbit polyclonal RAB5A antibody raised against the middle region of RAB5A

Synonyms Polyclonal RAB5A antibody, Anti-RAB5A antibody, RAB5A, RABA 5 antibody, RABA-5 antibody, RABA 5, RAB5 antibody, Rab5A Member Ras Oncogene Family antibody, RABA-5
Specificity RAB5A antibody was raised against the middle region of RAB5A
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen RAB5A antibody was raised using the middle region of RAB5A corresponding to a region with amino acids SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS
Assay Information RAB5A Blocking Peptide, catalog no. 33R-8417, is also available for use as a blocking control in assays to test for specificity of this RAB5A antibody

Images

Western Blot analysis using RAB5A antibody (70R-5861)

RAB5A antibody (70R-5861) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB5A is required for the fusion of plasma membranes and early endosomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAB5A antibody (70R-5861) | RAB5A antibody (70R-5861) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors