RAB5A antibody (70R-5861)
Rabbit polyclonal RAB5A antibody raised against the middle region of RAB5A
Overview
Overview
| Synonyms | Polyclonal RAB5A antibody, Anti-RAB5A antibody, RAB5A, RABA 5 antibody, RABA-5 antibody, RABA 5, RAB5 antibody, Rab5A Member Ras Oncogene Family antibody, RABA-5 |
|---|---|
| Specificity | RAB5A antibody was raised against the middle region of RAB5A |
| Cross Reactivity | Human,Mouse,Rat,Dog |
| Applications | WB |
| Immunogen | RAB5A antibody was raised using the middle region of RAB5A corresponding to a region with amino acids SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS |
| Assay Information | RAB5A Blocking Peptide, catalog no. 33R-8417, is also available for use as a blocking control in assays to test for specificity of this RAB5A antibody |
Images
Western Blot analysis using RAB5A antibody (70R-5861)
RAB5A antibody (70R-5861) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 24 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RAB5A is required for the fusion of plasma membranes and early endosomes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product