SIGLEC7 antibody (70R-6151)

Rabbit polyclonal SIGLEC7 antibody raised against the middle region of SIGLEC7

Synonyms Polyclonal SIGLEC7 antibody, Anti-SIGLEC7 antibody, QA79 antibody, CDw328 antibody, SIGLEC-7 antibody, AIRM1 antibody, p75 antibody, SIGLEC-7 antibody, SIGLEC 7, SIGLEC 7 antibody, p75/AIRM1 antibody, SIGLEC-7, D-siglec antibody, Sialic Acid Binding Ig-Like Lectin 7 antibody, SIGLEC7
Specificity SIGLEC7 antibody was raised against the middle region of SIGLEC7
Cross Reactivity Human
Applications WB
Immunogen SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ
Assay Information SIGLEC7 Blocking Peptide, catalog no. 33R-10007, is also available for use as a blocking control in assays to test for specificity of this SIGLEC7 antibody

Images

Western Blot analysis using SIGLEC7 antibody (70R-6151)

SIGLEC7 antibody (70R-6151) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SIGLEC7 antibody (70R-6151) | SIGLEC7 antibody (70R-6151) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €282.21
Size: 50 ug
OR
Shipping
View Our Distributors