SIGLEC7 antibody (70R-6151)
Rabbit polyclonal SIGLEC7 antibody raised against the middle region of SIGLEC7
Overview
Overview
| Synonyms | Polyclonal SIGLEC7 antibody, Anti-SIGLEC7 antibody, QA79 antibody, CDw328 antibody, SIGLEC-7 antibody, AIRM1 antibody, p75 antibody, SIGLEC-7 antibody, SIGLEC 7, SIGLEC 7 antibody, p75/AIRM1 antibody, SIGLEC-7, D-siglec antibody, Sialic Acid Binding Ig-Like Lectin 7 antibody, SIGLEC7 |
|---|---|
| Specificity | SIGLEC7 antibody was raised against the middle region of SIGLEC7 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ |
| Assay Information | SIGLEC7 Blocking Peptide, catalog no. 33R-10007, is also available for use as a blocking control in assays to test for specificity of this SIGLEC7 antibody |
Images
Western Blot analysis using SIGLEC7 antibody (70R-6151)
SIGLEC7 antibody (70R-6151) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 51 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product