IGSF1 antibody (70R-6152)

Rabbit polyclonal IGSF1 antibody raised against the N terminal of IGSF1

Synonyms Polyclonal IGSF1 antibody, Anti-IGSF1 antibody, Immunoglobulin Superfamily Member 1 antibody, IGSF 1, IGSF-1, MGC75490 antibody, PGSF2 antibody, KIAA0364 antibody, IGSF 1 antibody, IGCD1 antibody, IGDC1 antibody, IGSF-1 antibody, INHBP antibody, IGSF1
Specificity IGSF1 antibody was raised against the N terminal of IGSF1
Cross Reactivity Human
Applications WB
Immunogen IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD
Assay Information IGSF1 Blocking Peptide, catalog no. 33R-9971, is also available for use as a blocking control in assays to test for specificity of this IGSF1 antibody

Images

Western Blot analysis using IGSF1 antibody (70R-6152)

IGSF1 antibody (70R-6152) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 149 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IGSF1 antibody (70R-6152) | IGSF1 antibody (70R-6152) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €282.21
Size: 50 ug
OR
Shipping
View Our Distributors