IGSF1 antibody (70R-6152)
Rabbit polyclonal IGSF1 antibody raised against the N terminal of IGSF1
Overview
Overview
| Synonyms | Polyclonal IGSF1 antibody, Anti-IGSF1 antibody, Immunoglobulin Superfamily Member 1 antibody, IGSF 1, IGSF-1, MGC75490 antibody, PGSF2 antibody, KIAA0364 antibody, IGSF 1 antibody, IGCD1 antibody, IGDC1 antibody, IGSF-1 antibody, INHBP antibody, IGSF1 |
|---|---|
| Specificity | IGSF1 antibody was raised against the N terminal of IGSF1 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD |
| Assay Information | IGSF1 Blocking Peptide, catalog no. 33R-9971, is also available for use as a blocking control in assays to test for specificity of this IGSF1 antibody |
Images
Western Blot analysis using IGSF1 antibody (70R-6152)
IGSF1 antibody (70R-6152) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 149 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product