SIGLEC6 antibody (70R-6173)
Rabbit polyclonal SIGLEC6 antibody raised against the N terminal of SIGLEC6
Overview
Overview
| Synonyms | Polyclonal SIGLEC6 antibody, Anti-SIGLEC6 antibody, SIGLEC6, SIGLEC-6, SIGLEC-6 antibody, CDw327 antibody, OBBP1 antibody, SIGLEC 6, CD33L1 antibody, Sialic Acid Binding Ig-Like Lectin 6 antibody, CD33L antibody, SIGLEC 6 antibody, SIGLEC-6 antibody |
|---|---|
| Specificity | SIGLEC6 antibody was raised against the N terminal of SIGLEC6 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL |
| Assay Information | SIGLEC6 Blocking Peptide, catalog no. 33R-9741, is also available for use as a blocking control in assays to test for specificity of this SIGLEC6 antibody |
Images
Western Blot analysis using SIGLEC6 antibody (70R-6173)
SIGLEC6 antibody (70R-6173) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 47 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product