SIGLEC6 antibody (70R-6173)

Rabbit polyclonal SIGLEC6 antibody raised against the N terminal of SIGLEC6

Synonyms Polyclonal SIGLEC6 antibody, Anti-SIGLEC6 antibody, SIGLEC6, SIGLEC-6, SIGLEC-6 antibody, CDw327 antibody, OBBP1 antibody, SIGLEC 6, CD33L1 antibody, Sialic Acid Binding Ig-Like Lectin 6 antibody, CD33L antibody, SIGLEC 6 antibody, SIGLEC-6 antibody
Specificity SIGLEC6 antibody was raised against the N terminal of SIGLEC6
Cross Reactivity Human
Applications WB
Immunogen SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL
Assay Information SIGLEC6 Blocking Peptide, catalog no. 33R-9741, is also available for use as a blocking control in assays to test for specificity of this SIGLEC6 antibody

Images

Western Blot analysis using SIGLEC6 antibody (70R-6173)

SIGLEC6 antibody (70R-6173) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SIGLEC6 antibody (70R-6173) | SIGLEC6 antibody (70R-6173) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors