LYCAT antibody (70R-6247)

Rabbit polyclonal LYCAT antibody raised against the middle region of LYCAT

Synonyms Polyclonal LYCAT antibody, Anti-LYCAT antibody, ALCAT1 antibody, UNQ1849 antibody, FLJ37965 antibody, Lysocardiolipin Acyltransferase antibody
Specificity LYCAT antibody was raised against the middle region of LYCAT
Cross Reactivity Human
Applications WB
Immunogen LYCAT antibody was raised using the middle region of LYCAT corresponding to a region with amino acids YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
Assay Information LYCAT Blocking Peptide, catalog no. 33R-10186, is also available for use as a blocking control in assays to test for specificity of this LYCAT antibody

Images

Western Blot analysis using LYCAT antibody (70R-6247)

LYCAT antibody (70R-6247) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognises both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LYCAT antibody (70R-6247) | LYCAT antibody (70R-6247) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €282.21
Size: 50 ug
OR
Shipping
View Our Distributors