LYCAT antibody (70R-6247)
Rabbit polyclonal LYCAT antibody raised against the middle region of LYCAT
Overview
Overview
| Synonyms | Polyclonal LYCAT antibody, Anti-LYCAT antibody, ALCAT1 antibody, UNQ1849 antibody, FLJ37965 antibody, Lysocardiolipin Acyltransferase antibody |
|---|---|
| Specificity | LYCAT antibody was raised against the middle region of LYCAT |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | LYCAT antibody was raised using the middle region of LYCAT corresponding to a region with amino acids YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
| Assay Information | LYCAT Blocking Peptide, catalog no. 33R-10186, is also available for use as a blocking control in assays to test for specificity of this LYCAT antibody |
Images
Western Blot analysis using LYCAT antibody (70R-6247)
LYCAT antibody (70R-6247) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 44 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognises both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product