LRRN2 antibody (70R-6703)

Rabbit polyclonal LRRN2 antibody raised against the middle region of LRRN2

Synonyms Polyclonal LRRN2 antibody, Anti-LRRN2 antibody, Leucine Rich Repeat Neuronal 2 antibody, LRRN2, FIGLER7 antibody, LRANK1 antibody, LRRN-2, LRRN-2 antibody, LRRN 2 antibody, LRRN5 antibody, GAC1 antibody, LRRN 2
Specificity LRRN2 antibody was raised against the middle region of LRRN2
Cross Reactivity Human
Applications WB
Immunogen LRRN2 antibody was raised using the middle region of LRRN2 corresponding to a region with amino acids RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS
Assay Information LRRN2 Blocking Peptide, catalog no. 33R-8253, is also available for use as a blocking control in assays to test for specificity of this LRRN2 antibody

Images

Western Blot analysis using LRRN2 antibody (70R-6703)

LRRN2 antibody (70R-6703) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LRRN2 antibody (70R-6703) | LRRN2 antibody (70R-6703) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors