LRRN2 antibody (70R-6703)
Rabbit polyclonal LRRN2 antibody raised against the middle region of LRRN2
Overview
Overview
| Synonyms | Polyclonal LRRN2 antibody, Anti-LRRN2 antibody, Leucine Rich Repeat Neuronal 2 antibody, LRRN2, FIGLER7 antibody, LRANK1 antibody, LRRN-2, LRRN-2 antibody, LRRN 2 antibody, LRRN5 antibody, GAC1 antibody, LRRN 2 |
|---|---|
| Specificity | LRRN2 antibody was raised against the middle region of LRRN2 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | LRRN2 antibody was raised using the middle region of LRRN2 corresponding to a region with amino acids RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS |
| Assay Information | LRRN2 Blocking Peptide, catalog no. 33R-8253, is also available for use as a blocking control in assays to test for specificity of this LRRN2 antibody |
Images
Western Blot analysis using LRRN2 antibody (70R-6703)
LRRN2 antibody (70R-6703) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 79 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product