OSBPL8 antibody (70R-6725)
Rabbit polyclonal OSBPL8 antibody raised against the N terminal of OSBPL8
Overview
Overview
| Synonyms | Polyclonal OSBPL8 antibody, Anti-OSBPL8 antibody, OSBP10 antibody, MST120 antibody, OSBPL-8, MSTP120 antibody, DKFZp686A11164 antibody, OSBPL8, ORP8 antibody, OSBPL 8, MGC133203 antibody, MGC126578 antibody, OSBPL 8 antibody, OSBPL-8 antibody, Oxysterol Binding Protein-Like 8 antibody |
|---|---|
| Specificity | OSBPL8 antibody was raised against the N terminal of OSBPL8 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS |
| Assay Information | OSBPL8 Blocking Peptide, catalog no. 33R-8722, is also available for use as a blocking control in assays to test for specificity of this OSBPL8 antibody |
Images
Western Blot analysis using OSBPL8 antibody (70R-6725)
OSBPL8 antibody (70R-6725) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 97 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product