ABHD13 antibody (70R-6949)
Rabbit polyclonal ABHD13 antibody raised against the N terminal of ABHD13
Overview
Overview
| Synonyms | Polyclonal ABHD13 antibody, Anti-ABHD13 antibody, bA153I24.2 antibody, MGC27058 antibody, FLJ14906 antibody, RP11-153I24.2 antibody, Abhydrolase Domain Containing 13 antibody, C13orf6 antibody, BEM46L1 antibody |
|---|---|
| Specificity | ABHD13 antibody was raised against the N terminal of ABHD13 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN |
| Assay Information | ABHD13 Blocking Peptide, catalog no. 33R-8762, is also available for use as a blocking control in assays to test for specificity of this ABHD13 antibody |
Images
Western Blot analysis using ABHD13 antibody (70R-6949)
ABHD13 antibody (70R-6949) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 38 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product