ABHD13 antibody (70R-6949)

Rabbit polyclonal ABHD13 antibody raised against the N terminal of ABHD13

Synonyms Polyclonal ABHD13 antibody, Anti-ABHD13 antibody, bA153I24.2 antibody, MGC27058 antibody, FLJ14906 antibody, RP11-153I24.2 antibody, Abhydrolase Domain Containing 13 antibody, C13orf6 antibody, BEM46L1 antibody
Specificity ABHD13 antibody was raised against the N terminal of ABHD13
Cross Reactivity Human
Applications WB
Immunogen ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN
Assay Information ABHD13 Blocking Peptide, catalog no. 33R-8762, is also available for use as a blocking control in assays to test for specificity of this ABHD13 antibody

Images

Western Blot analysis using ABHD13 antibody (70R-6949)

ABHD13 antibody (70R-6949) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ABHD13 antibody (70R-6949) | ABHD13 antibody (70R-6949) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors