STOML3 antibody (70R-7076)

Rabbit polyclonal STOML3 antibody

Synonyms Polyclonal STOML3 antibody, Anti-STOML3 antibody, Epb7.2l antibody, STOML 3 antibody, STOML 3, STOML-3 antibody, Epb72-Like 3 antibody, STOML-3, SRO antibody, STOML3, Stomatin like 3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC
Assay Information STOML3 Blocking Peptide, catalog no. 33R-8431, is also available for use as a blocking control in assays to test for specificity of this STOML3 antibody

Images

Western Blot analysis using STOML3 antibody (70R-7076)

STOML3 antibody (70R-7076) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of STOML3 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STOML3 antibody (70R-7076) | STOML3 antibody (70R-7076) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors