STOML3 antibody (70R-7076)
Rabbit polyclonal STOML3 antibody
Overview
Overview
| Synonyms | Polyclonal STOML3 antibody, Anti-STOML3 antibody, Epb7.2l antibody, STOML 3 antibody, STOML 3, STOML-3 antibody, Epb72-Like 3 antibody, STOML-3, SRO antibody, STOML3, Stomatin like 3 antibody |
|---|---|
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC |
| Assay Information | STOML3 Blocking Peptide, catalog no. 33R-8431, is also available for use as a blocking control in assays to test for specificity of this STOML3 antibody |
Images
Western Blot analysis using STOML3 antibody (70R-7076)
STOML3 antibody (70R-7076) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 32 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of STOML3 protein is not widely studied, and is yet to be elucidated fully. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product