LOC161247 antibody (70R-7083)
Rabbit polyclonal LOC161247 antibody raised against the middle region of Loc161247
Overview
Overview
| Synonyms | Polyclonal LOC161247 antibody, Anti-LOC161247 antibody, LOC 161247, LOC-161247 antibody, LOC161247, MGC46490 antibody, LOC 161247 antibody, LOC-161247 |
|---|---|
| Specificity | LOC161247 antibody was raised against the middle region of Loc161247 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | LOC161247 antibody was raised using the middle region of Loc161247 corresponding to a region with amino acids YFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKH |
| Assay Information | LOC161247 Blocking Peptide, catalog no. 33R-10094, is also available for use as a blocking control in assays to test for specificity of this LOC161247 antibody |
Images
Western Blot analysis using LOC161247 antibody (70R-7083)
LOC161247 antibody (70R-7083) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 32 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | FIT1 (LOC161247) belongs to an evolutionarily conserved family of proteins involved in fat storage. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product