PH4 antibody (70R-7088)

Rabbit polyclonal PH4 antibody raised against the middle region of PH-4

Synonyms Polyclonal PH4 antibody, Anti-PH4 antibody, Hypoxia-Inducible Factor Prolyl 4-Hydroxylase antibody, PH-4, PH 4, PH4, PH-4 antibody, PH 4 antibody, P4H-TM antibody, PH-4 antibody
Specificity PH4 antibody was raised against the middle region of PH-4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH
Assay Information PH4 Blocking Peptide, catalog no. 33R-8025, is also available for use as a blocking control in assays to test for specificity of this PH4 antibody

Images

Western Blot analysis using PH4 antibody (70R-7088)

PH4 antibody (70R-7088) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PH4 antibody (70R-7088) | PH4 antibody (70R-7088) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors