PH4 antibody (70R-7088)
Rabbit polyclonal PH4 antibody raised against the middle region of PH-4
Overview
Overview
| Synonyms | Polyclonal PH4 antibody, Anti-PH4 antibody, Hypoxia-Inducible Factor Prolyl 4-Hydroxylase antibody, PH-4, PH 4, PH4, PH-4 antibody, PH 4 antibody, P4H-TM antibody, PH-4 antibody |
|---|---|
| Specificity | PH4 antibody was raised against the middle region of PH-4 |
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH |
| Assay Information | PH4 Blocking Peptide, catalog no. 33R-8025, is also available for use as a blocking control in assays to test for specificity of this PH4 antibody |
Images
Western Blot analysis using PH4 antibody (70R-7088)
PH4 antibody (70R-7088) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 57 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product