SEMA6D antibody (70R-7125)
Rabbit polyclonal SEMA6D antibody raised against the N terminal of SEMA6D
Overview
Overview
| Synonyms | Polyclonal SEMA6D antibody, Anti-SEMA6D antibody, SEMAD 6, SEMAD 6 antibody, KIAA1479 antibody, FLJ11598 antibody, SEMAD-6 antibody, Sema Domain Immunoglobulin Domain 6D antibody, SEMAD-6, SEMA6D |
|---|---|
| Specificity | SEMA6D antibody was raised against the N terminal of SEMA6D |
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | SEMA6D antibody was raised using the N terminal of SEMA6D corresponding to a region with amino acids VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY |
| Assay Information | SEMA6D Blocking Peptide, catalog no. 33R-9805, is also available for use as a blocking control in assays to test for specificity of this SEMA6D antibody |
Images
Western Blot analysis using SEMA6D antibody (70R-7125)
SEMA6D antibody (70R-7125) used at 0.5 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 52 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 0.5 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product