ACPT antibody (70R-7296)
Rabbit polyclonal ACPT antibody raised against the middle region of ACPT
Overview
Overview
| Synonyms | Polyclonal ACPT antibody, Anti-ACPT antibody, Acid Phosphatase Testicular antibody |
|---|---|
| Specificity | ACPT antibody was raised against the middle region of ACPT |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND |
| Assay Information | ACPT Blocking Peptide, catalog no. 33R-9175, is also available for use as a blocking control in assays to test for specificity of this ACPT antibody |
Images
Western Blot analysis using ACPT antibody (70R-7296)
ACPT antibody (70R-7296) used at 0.5 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 43 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 0.5 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. ACPT has structural similarity to prostatic and lysosomal acid phosphatases. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product