ACPT antibody (70R-7296)

Rabbit polyclonal ACPT antibody raised against the middle region of ACPT

Synonyms Polyclonal ACPT antibody, Anti-ACPT antibody, Acid Phosphatase Testicular antibody
Specificity ACPT antibody was raised against the middle region of ACPT
Cross Reactivity Human
Applications WB
Immunogen ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND
Assay Information ACPT Blocking Peptide, catalog no. 33R-9175, is also available for use as a blocking control in assays to test for specificity of this ACPT antibody

Images

Western Blot analysis using ACPT antibody (70R-7296)

ACPT antibody (70R-7296) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. ACPT has structural similarity to prostatic and lysosomal acid phosphatases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACPT antibody (70R-7296) | ACPT antibody (70R-7296) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors