TEX264 antibody (70R-7352)

Rabbit polyclonal TEX264 antibody raised against the middle region of TEX264

Synonyms Polyclonal TEX264 antibody, Anti-TEX264 antibody, TEX-264 antibody, SIG11 antibody, Testis Expressed 264 antibody, TEX 264 antibody, TEX-264, FLJ13935 antibody, TEX 264, TEX264, DKFZp451H0417 antibody, ZSIG11 antibody
Specificity TEX264 antibody was raised against the middle region of TEX264
Cross Reactivity Human,Mouse
Applications WB
Immunogen TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV
Assay Information TEX264 Blocking Peptide, catalog no. 33R-8543, is also available for use as a blocking control in assays to test for specificity of this TEX264 antibody

Images

Western Blot analysis using TEX264 antibody (70R-7352)

TEX264 antibody (70R-7352) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of TEX264 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TEX264 antibody (70R-7352) | TEX264 antibody (70R-7352) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors