TEX264 antibody (70R-7352)
Rabbit polyclonal TEX264 antibody raised against the middle region of TEX264
Overview
Overview
| Synonyms | Polyclonal TEX264 antibody, Anti-TEX264 antibody, TEX-264 antibody, SIG11 antibody, Testis Expressed 264 antibody, TEX 264 antibody, TEX-264, FLJ13935 antibody, TEX 264, TEX264, DKFZp451H0417 antibody, ZSIG11 antibody |
|---|---|
| Specificity | TEX264 antibody was raised against the middle region of TEX264 |
| Cross Reactivity | Human,Mouse |
| Applications | WB |
| Immunogen | TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV |
| Assay Information | TEX264 Blocking Peptide, catalog no. 33R-8543, is also available for use as a blocking control in assays to test for specificity of this TEX264 antibody |
Images
Western Blot analysis using TEX264 antibody (70R-7352)
TEX264 antibody (70R-7352) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 34 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The specific function of TEX264 is not yet known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product