CA2 Blocking Peptide (33R-2905)

A synthetic peptide for use as a blocking control in assays to test for specificity of CA2 antibody, catalog no. 70R-9978

Synonyms CA2 control peptide, CA2 antibody Blocking Peptide, Anti-CA2 Blocking Peptide, carbonic anhydrase II Blocking Peptide, CA-II Blocking Peptide, CAII Blocking Peptide, Car2 Blocking Peptide, CA2, CA-2, CA 2, CA-2 Blocking Peptide, CA 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues FGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFD
Molecular Weight 29 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CA2 is essential for bone resorption and osteoclast differentiation. CA2 is implicated in reversible hydration of carbon dioxide. CA2 can hydrates cyanamide to urea. CA2 is involved in the regulation of fluid secretion into the anterior chamber of the eye.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors