CA2 Blocking Peptide (33R-2905)
A synthetic peptide for use as a blocking control in assays to test for specificity of CA2 antibody, catalog no. 70R-9978
Overview
Overview
| Synonyms | CA2 control peptide, CA2 antibody Blocking Peptide, Anti-CA2 Blocking Peptide, carbonic anhydrase II Blocking Peptide, CA-II Blocking Peptide, CAII Blocking Peptide, Car2 Blocking Peptide, CA2, CA-2, CA 2, CA-2 Blocking Peptide, CA 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | FGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFD |
|---|---|
| Molecular Weight | 29 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CA2 is essential for bone resorption and osteoclast differentiation. CA2 is implicated in reversible hydration of carbon dioxide. CA2 can hydrates cyanamide to urea. CA2 is involved in the regulation of fluid secretion into the anterior chamber of the eye. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product