PON3 Blocking Peptide (33R-2947)
A synthetic peptide for use as a blocking control in assays to test for specificity of PON3 antibody, catalog no. 70R-6930
Overview
Overview
| Synonyms | PON3 control peptide, PON3 antibody Blocking Peptide, Anti-PON3 Blocking Peptide, Paraoxonase 3 Blocking Peptide, PON3, PON-3, PON 3, PON-3 Blocking Peptide, PON 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | FKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSF |
|---|---|
| Molecular Weight | 39 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product