GPC3 Blocking Peptide (33R-3080)

A synthetic peptide for use as a blocking control in assays to test for specificity of GPC3 antibody, catalog no. 70R-1567

Synonyms GPC3 control peptide, GPC3 antibody Blocking Peptide, Anti-GPC3 Blocking Peptide, Glypican 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
Molecular Weight 64 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors