GPC3 Blocking Peptide (33R-3080)
A synthetic peptide for use as a blocking control in assays to test for specificity of GPC3 antibody, catalog no. 70R-1567
Overview
Overview
| Synonyms | GPC3 control peptide, GPC3 antibody Blocking Peptide, Anti-GPC3 Blocking Peptide, Glypican 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL |
|---|---|
| Molecular Weight | 64 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product