ZMIZ2 Blocking Peptide (33R-3876)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZMIZ2 antibody, catalog no. 70R-10130

Synonyms ZMIZ2 control peptide, ZMIZ2 antibody Blocking Peptide, Anti-ZMIZ2 Blocking Peptide, zinc finger, MIZ-type containing 2 Blocking Peptide, DKFZp761I2123 Blocking Peptide, KIAA1886 Blocking Peptide, ZIMP7 Blocking Peptide, hZIMP7 Blocking Peptide, ZMIZ2, ZMIZ-2, ZMIZ 2, ZMIZ-2 Blocking Peptide, ZMIZ 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues HYKPTRSIPGYPSSPLPGNPTPPMTPSSSVPYMSPNQEVKSPFLPDLKPN
Molecular Weight 94 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZMIZ2 and ZMIZ1 are members of a PIAS -like family of proteins that interact with nuclear hormone receptors. ZMIZ2 interacts with androgen receptor and enhances AR-mediated transcription

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors