ZMIZ2 Blocking Peptide (33R-3876)
A synthetic peptide for use as a blocking control in assays to test for specificity of ZMIZ2 antibody, catalog no. 70R-10130
Overview
Overview
| Synonyms | ZMIZ2 control peptide, ZMIZ2 antibody Blocking Peptide, Anti-ZMIZ2 Blocking Peptide, zinc finger, MIZ-type containing 2 Blocking Peptide, DKFZp761I2123 Blocking Peptide, KIAA1886 Blocking Peptide, ZIMP7 Blocking Peptide, hZIMP7 Blocking Peptide, ZMIZ2, ZMIZ-2, ZMIZ 2, ZMIZ-2 Blocking Peptide, ZMIZ 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | HYKPTRSIPGYPSSPLPGNPTPPMTPSSSVPYMSPNQEVKSPFLPDLKPN |
|---|---|
| Molecular Weight | 94 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ZMIZ2 and ZMIZ1 are members of a PIAS -like family of proteins that interact with nuclear hormone receptors. ZMIZ2 interacts with androgen receptor and enhances AR-mediated transcription |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product