SPSB2 Blocking Peptide (33R-3978)

A synthetic peptide for use as a blocking control in assays to test for specificity of SPSB2 antibody, catalog no. 70R-10124

Synonyms SPSB2 control peptide, SPSB2 antibody Blocking Peptide, Anti-SPSB2 Blocking Peptide, splA/ryanodine receptor domain and SOCS box containing 2 Blocking Peptide, FLJ17395 Blocking Peptide, GRCC9 Blocking Peptide, MGC2519 Blocking Peptide, SSB2 Blocking Peptide, SPSB2, SPSB-2, SPSB 2, SPSB-2 Blocking Peptide, SPSB 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors