SPSB2 Blocking Peptide (33R-3978)
A synthetic peptide for use as a blocking control in assays to test for specificity of SPSB2 antibody, catalog no. 70R-10124
Overview
Overview
| Synonyms | SPSB2 control peptide, SPSB2 antibody Blocking Peptide, Anti-SPSB2 Blocking Peptide, splA/ryanodine receptor domain and SOCS box containing 2 Blocking Peptide, FLJ17395 Blocking Peptide, GRCC9 Blocking Peptide, MGC2519 Blocking Peptide, SSB2 Blocking Peptide, SPSB2, SPSB-2, SPSB 2, SPSB-2 Blocking Peptide, SPSB 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product