MRPL49 Blocking Peptide (33R-4069)
A synthetic peptide for use as a blocking control in assays to test for specificity of MRPL49 antibody, catalog no. 70R-9977
Overview
Overview
| Synonyms | MRPL49 control peptide, MRPL49 antibody Blocking Peptide, Anti-MRPL49 Blocking Peptide, mitochondrial ribosomal protein L49 Blocking Peptide, C11orf4 Blocking Peptide, L49mt Blocking Peptide, MGC10656 Blocking Peptide, NOF Blocking Peptide, NOF1 Blocking Peptide, MRPL49, MRPL-49, MRPL 49, MRPL-49 Blocking Peptide, MRPL 49 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ |
|---|---|
| Molecular Weight | 79 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. This gene and the gene for the HRD1 protein use in their respective 3' UTRs some of the same genomic sequence. Pseudogenes corresponding to this gene are found on chromosomes 5q and 8p. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product