CYP21A2 Blocking Peptide (33R-4122)
A synthetic peptide for use as a blocking control in assays to test for specificity of CYP21A2 antibody, catalog no. 70R-9997
Overview
Overview
| Synonyms | CYP21A2 control peptide, CYP21A2 antibody Blocking Peptide, Anti-CYP21A2 Blocking Peptide, cytochrome P450, family 21, subfamily A, polypeptide 2 Blocking Peptide, CA21H Blocking Peptide, CAH1 Blocking Peptide, CPS1 Blocking Peptide, CYP21 Blocking Peptide, CYP21B Blocking Peptide, MGC150536 Blocking Peptide, MGC150537 Blocking Peptide, P450c21B Blocking Peptide, CYP21A2, CYPA2-21, CYPA2 21, CYPA2-21 Blocking Peptide, CYPA2 21 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA |
|---|---|
| Molecular Weight | 56 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product