DDB2 Blocking Peptide (33R-4210)
A synthetic peptide for use as a blocking control in assays to test for specificity of DDB2 antibody, catalog no. 70R-10002
Overview
Overview
| Synonyms | DDB2 control peptide, DDB2 antibody Blocking Peptide, Anti-DDB2 Blocking Peptide, damage-specific DNA binding protein 2, 48kDa Blocking Peptide, DDBB Blocking Peptide, FLJ34321 Blocking Peptide, UV-DDB2 Blocking Peptide, DDB2, DDB-2, DDB 2, DDB-2 Blocking Peptide, DDB 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF |
|---|---|
| Molecular Weight | 48 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product