MAPKAPK3 Blocking Peptide (33R-4327)

A synthetic peptide for use as a blocking control in assays to test for specificity of MAPKAPK3 antibody, catalog no. 70R-10035

Synonyms MAPKAPK3 control peptide, MAPKAPK3 antibody Blocking Peptide, Anti-MAPKAPK3 Blocking Peptide, mitogen-activated protein kinase-activated protein kinase 3 Blocking Peptide, 3PK Blocking Peptide, MAPKAP3 Blocking Peptide, MAPKAPK3, MAPKAPK-3, MAPKAPK 3, MAPKAPK-3 Blocking Peptide, MAPKAPK 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNN
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAPKAPK3 is a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors