MAPKAPK2 Blocking Peptide (33R-4542)

A synthetic peptide for use as a blocking control in assays to test for specificity of MAPKAPK2 antibody, catalog no. 70R-10034

Synonyms MAPKAPK2 control peptide, MAPKAPK2 antibody Blocking Peptide, Anti-MAPKAPK2 Blocking Peptide, mitogen-activated protein kinase-activated protein kinase 3 Blocking Peptide, 3PK Blocking Peptide, MAPKAP3 Blocking Peptide, MAPKAPK2, MAPKAPK-2, MAPKAPK 2, MAPKAPK-2 Blocking Peptide, MAPKAPK 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY
Molecular Weight 42 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAPKAPK2 is a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors