CYP11B1 Blocking Peptide (33R-4783)

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP11B1 antibody, catalog no. 70R-9996

Synonyms CYP11B1 control peptide, CYP11B1 antibody Blocking Peptide, Anti-CYP11B1 Blocking Peptide, cytochrome P450, family 11, subfamily B, polypeptide 1 Blocking Peptide, CPN1 Blocking Peptide, CYP11B Blocking Peptide, DKFZp686B05283 Blocking Peptide, FHI Blocking Peptide, FLJ36771 Blocking Peptide, P450C11 Blocking Peptide, CYP11B1, CYPB1-11, CYPB1 11, CYPB1-11 Blocking Peptide, CYPB1 11 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK
Molecular Weight 55 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors